The store will not work correctly when cookies are disabled.
Protein or Target Summary
UDP-glucuronosyltransferase 2B15
| Gene ID | 7366 |
|---|
| uniprot | P54855 |
|---|
| Gene Name | UGT2B15 |
|---|
| Ensernbl ID | ENSP00000341045 |
|---|
| Family | Belongs to the UDP-glycosyltransferase family. |
|---|
| Sequence | MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7366 | UGT2B15 | UDP-glucuronosyltransferase 2B15 | P54855 |
| RAT | | Ugt2b15 | UDP-glucuronosyltransferase | F1M3E3 |
| RAT | | Ugt2b15 | UDP-glucuronosyltransferase | D3ZLR6 |
| RAT | | Ugt2b15 | UDP-glucuronosyltransferase 2B15 | P36511 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
