| Description | Transcription elongation factor SPT4 |
|---|
Gene and Protein Information
| Gene ID | 6827 |
|---|---|
| Uniprot Accession IDs | B2R4X8 D3DTZ4 Q16550 Q62387 Q6ZP89 hSPT4 |
| Ensembl ID | ENSP00000225504 |
| Symbol | SPT4H SUPT4H SPT4 SPT4H SUPT4H Supt4a |
| Family | Belongs to the SPT4 family. |
| Sequence | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468422 | SUPT4H1 | SPT4 homolog, DSIF elongation factor subunit | 9598 | VGNC:9668 | OMA, EggNOG |
| Mouse | 20922 | Supt4a | suppressor of Ty 4A | 10090 | MGI:107416 | Inparanoid, OMA |
| Rat | 287608 | Supt4h1 | SPT4 homolog, DSIF elongation factor subunit | 10116 | RGD:1306372 | Inparanoid, OMA |
| Dog | 609757 | SUPT4H1 | SPT4 homolog, DSIF elongation factor subunit | 9615 | VGNC:46991 | Inparanoid, OMA, EggNOG |
| Horse | 100056960 | SUPT4H1 | SPT4 homolog, DSIF elongation factor subunit | 9796 | VGNC:23765 | Inparanoid, OMA, EggNOG |
| Cow | 616425 | SUPT4H1 | SPT4 homolog, DSIF elongation factor subunit | 9913 | VGNC:35480 | Inparanoid, OMA, EggNOG |
| Opossum | 100022141 | LOC100022141 | transcription elongation factor SPT4-A-like | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 417470 | SUPT4H1 | SPT4 homolog, DSIF elongation factor subunit | 9031 | CGNC:692 | Inparanoid, OMA, EggNOG |
| Xenopus | 549433 | supt4h1 | SPT4 homolog, DSIF elongation factor subunit | 8364 | XB-GENE-977391 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436782 | supt4h1 | SPT4 homolog, DSIF elongation factor subunit | 7955 | ZDB-GENE-040718-214 | Inparanoid, OMA |
| C. elegans | 175172 | spt-4 | Transcription elongation factor SPT4 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 36387 | spt4 | CG12372 gene product from transcript CG12372-RA | 7227 | FBgn0028683 | Inparanoid, EggNOG |
| S.cerevisiae | 852955 | SPT4 | transcription elongation factor SPT4 | 4932 | S000003295 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / chromatin/chromatin-binding protein / Transcription elongation factor SPT4
protein / nucleic acid binding / transcription factor / Transcription elongation factor SPT4
protein / nucleic acid binding / chromatin/chromatin-binding protein / Transcription elongation factor SPT4
protein / nucleic acid binding / transcription factor / Transcription elongation factor SPT4
DTO Classes
protein / Nucleic acid binding / DNA binding protein / Chromatin/chromatin-binding protein / Transcription elongation factor SPT4
protein / Nucleic acid binding / DNA binding protein / Chromatin/chromatin-binding protein / Transcription elongation factor SPT4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|