JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
TAS2R7

TAS2R7

Description	Taste receptor type 2 member 7

Gene and Protein Information

Gene ID	50837
Uniprot Accession IDs	Q645Y1 T2R7
Ensembl ID	ENSP00000240687
Symbol	T2R7 TRB4
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLCVILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFLWMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISFLLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVIWKVMSILKGRKFQQHKQI Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	107967742	TAS2R7	taste 2 receptor member 7	9598		Inparanoid, OMA
Mouse	387355	Tas2r130	taste receptor, type 2, member 130	10090	MGI:2681278	Inparanoid, OMA
Rat	690334	Tas2r130	taste receptor, type 2, member 130	10116	RGD:1597354	Inparanoid, OMA
Dog	100271739	TAS2R7	taste 2 receptor member 7	9615	VGNC:47121	Inparanoid, OMA
Horse	106783277	TAS2R7	taste 2 receptor member 7	9796		Inparanoid, OMA
Opossum	664676	T2R7B	bitter taste receptor Modo-T2R7B	13616		Inparanoid, OMA

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]