TACSTD2

DescriptionTumor-associated calcium signal transducer 2

Gene and Protein Information

Gene ID4070
Uniprot Accession IDs Q15658 Q6FG48 Q7Z7Q4 Q96QD2
Ensembl ID ENSP00000360269
Symbol GA733-1 M1S1 TROP2 EGP1 GP50 M1S1 EGP-1 TROP2 GA7331 GA733-1
FamilyBelongs to the EPCAM family.
Sequence
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp456890TACSTD2tumor associated calcium signal transducer 29598OMA, EggNOG
Macaque716334TACSTD2tumor associated calcium signal transducer 29544Inparanoid, OMA, EggNOG
Mouse56753Tacstd2tumor-associated calcium signal transducer 210090MGI:1861606Inparanoid, OMA, EggNOG
Rat494343Tacstd2tumor-associated calcium signal transducer 210116RGD:1359498Inparanoid, OMA, EggNOG
Cow539853TACSTD2tumor associated calcium signal transducer 29913VGNC:35563Inparanoid, OMA, EggNOG
Pig100510966TACSTD2tumor associated calcium signal transducer 29823OMA, EggNOG
Opossum100032064TACSTD2tumor associated calcium signal transducer 213616Inparanoid, OMA, EggNOG
Anole lizardTACSTD2tumor associated calcium signal transducer 2 [Source:HGNC Symbol;Acc:HGNC:11530]28377Inparanoid, OMA, EggNOG
Xenopus496567epcamepithelial cell adhesion molecule8364XB-GENE-986667OMA, EggNOG
Zebrafish406454epcamepithelial cell adhesion molecule7955ZDB-GENE-040426-2209Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source