| Description | ETS domain-containing protein Elk-1 |
|---|
Gene and Protein Information
| Gene ID | 2002 |
|---|---|
| Uniprot Accession IDs | B2R7H4 O75606 O95058 Q969X8 Q9UJM4 |
| Ensembl ID | ENSP00000483056 |
| Family | Belongs to the ETS family. |
| Sequence | MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 473591 | ELK1 | ELK1, ETS transcription factor | 9598 | VGNC:12308 | OMA, EggNOG |
| Mouse | 13712 | Elk1 | ELK1, member of ETS oncogene family | 10090 | MGI:101833 | Inparanoid, OMA, EggNOG |
| Rat | 314436 | Elk1 | ELK1, ETS transcription factor | 10116 | RGD:1598663 | Inparanoid, OMA, EggNOG |
| Dog | 491860 | ELK1 | ELK1, ETS transcription factor | 9615 | VGNC:40303 | Inparanoid, OMA, EggNOG |
| Horse | 100051388 | ELK1 | ELK1, ETS transcription factor | 9796 | VGNC:17523 | Inparanoid, OMA, EggNOG |
| Cow | 786886 | ELK1 | ELK1, ETS transcription factor | 9913 | VGNC:28432 | Inparanoid, OMA, EggNOG |
| Pig | 100522002 | ELK1 | ELK1, ETS transcription factor | 9823 | Inparanoid, OMA | |
| Opossum | ELK1 | ELK1, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3321] | 13616 | OMA, EggNOG | ||
| Anole lizard | ELK1 | ELK1, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3321] | 28377 | OMA, EggNOG | ||
| Xenopus | 100497609 | elk1 | ELK1, member of ETS oncogene family | 8364 | XB-GENE-5992134 | Inparanoid, OMA, EggNOG |
| Zebrafish | 567895 | elk1 | ELK1, member of ETS oncogene family | 7955 | ZDB-GENE-090529-5 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transcription factor / ETS domain-containing protein Elk-1
protein / signaling molecule / ETS domain-containing protein Elk-1
protein / winged helix/forkhead transcription factor / ETS domain-containing protein Elk-1
protein / nucleic acid binding / ETS domain-containing protein Elk-1
protein / transcription factor / ETS domain-containing protein Elk-1
protein / signaling molecule / ETS domain-containing protein Elk-1
protein / winged helix/forkhead transcription factor / ETS domain-containing protein Elk-1
protein / nucleic acid binding / ETS domain-containing protein Elk-1
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / ETS domain-containing protein Elk-1
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / ETS domain-containing protein Elk-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|