Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

TUBB

DescriptionTubulin beta chain

Gene and Protein Information

Gene ID203068
Uniprot Accession IDs P07437 P05218 Q8WUC1 Q9CY33
Ensembl ID ENSP00000339001
Symbol TUBB5 M40 TUBB1 TUBB5 CDCBM6 CSCSC1 OK/SW-cl.56
FamilyBelongs to the tubulin family.
Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque574113TUBBtubulin beta class I9544Inparanoid, EggNOG
Mouse22154Tubb5tubulin, beta 5 class I10090MGI:107812Inparanoid, OMA, EggNOG
Rat29214Tubb5tubulin, beta 5 class I10116RGD:628596Inparanoid, OMA
Dog474830TUBBtubulin beta class I9615Inparanoid, OMA, EggNOG
Horse100051013TUBBtubulin beta class I9796VGNC:49368Inparanoid, OMA, EggNOG
Cow615087TUBBtubulin beta class I9913Inparanoid, OMA, EggNOG
Pig733686TUBBtubulin beta class I9823Inparanoid, OMA, EggNOG
Opossum100022562TUBBtubulin beta class I13616Inparanoid, OMA, EggNOG
Xenopus448742tubbtubulin beta class I8364XB-GENE-482185Inparanoid, OMA
Zebrafish386701tubb5tubulin, beta 57955ZDB-GENE-031110-4Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    tubulin    /    Tubulin beta chain
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Tubulin    /    Tubulin beta chain

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Monzó, M M and 10 more authors. 1999-06 Paclitaxel resistance in non-small-cell lung cancer associated with beta-tubulin gene mutations. [PMID:10561216]
      2.Tarazona, R R and 6 more authors. 2000-12-15 HLA-B2702 (77-83/83-77) peptide binds to beta-tubulin on human NK cells and blocks their cytotoxic capacity. [PMID:11120798]
      3.Crabtree, D V DV, Ojima, I I, Geng, X X and Adler, A J AJ. 2001-08 Tubulins in the primate retina: evidence that xanthophylls may be endogenous ligands for the paclitaxel-binding site. [PMID:11504633]
      4.Tsurutani, Junji J and 8 more authors. 2002-01 Mutational analysis of the beta-tubulin gene in lung cancer. [PMID:11750707]
      5.Hasegawa, Seiichi S and 6 more authors. 2002-09-01 Mutational analysis of the class I beta-tubulin gene in human breast cancer. [PMID:12209587]
      6.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      7.Wubbolts, Richard R and 8 more authors. 2003-03-28 Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation. [PMID:12519789]
      8.de Castro, J J and 10 more authors. 2003-07 New insights in beta-tubulin sequence analysis in non-small cell lung cancer. [PMID:12826311]
      9.Casenghi, Martina M and 5 more authors. 2003-07 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation. [PMID:12852856]
      10.Maeno, Kazuma K and 8 more authors. 2003-07-30 Mutation of the class I beta-tubulin gene does not predict response to paclitaxel for breast cancer. [PMID:12893435]