The store will not work correctly when cookies are disabled.
Protein or Target Summary
T-cell leukemia/lymphoma protein 1A
| Gene ID | 8115 |
|---|
| uniprot | P56279 |
|---|
| Gene Name | TCL1A |
|---|
| Ensernbl ID | ENSP00000385036 |
|---|
| Family | Belongs to the TCL1 family. |
|---|
| Sequence | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 8115 | TCL1A | T-cell leukemia/lymphoma protein 1A | P56279 |
| MOUSE | 21432 | Tcl1a | T-cell leukemia/lymphoma protein 1A | P56280 |
| RAT | 690575 | Tcl1a | RCG20625, isoform CRA_a | D3ZWG3 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
