The store will not work correctly when cookies are disabled.
TCL1A
| Description | T-cell leukemia/lymphoma protein 1A |
|---|
Gene and Protein Information
| Gene ID | 8115 |
|---|
| Uniprot Accession IDs | Q6IBK7 |
|---|
| Ensembl ID | ENSP00000385036 |
|---|
| Symbol | TCL1 TCL1 |
|---|
| Family | Belongs to the TCL1 family. |
|---|
| Sequence | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
