The store will not work correctly when cookies are disabled.
TCL1A
Description | T-cell leukemia/lymphoma protein 1A |
---|
Gene and Protein Information
Gene ID | 8115 |
Uniprot Accession IDs | Q6IBK7 |
Ensembl ID | ENSP00000385036 |
Symbol | TCL1 TCL1 |
Family | Belongs to the TCL1 family. |
Sequence | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
---|
Homologous gene and protein info.
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|