JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

TFF2

Description	Trefoil factor 2

Gene and Protein Information

Gene ID	7032
Uniprot Accession IDs	Q15854
Ensembl ID	ENSP00000291526
Symbol	SML1 SP SML1
Sequence	MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	470096	TFF2	trefoil factor 2	9598	VGNC:1119	OMA, EggNOG
Macaque	714550	TFF2	trefoil factor 2	9544		OMA, EggNOG
Mouse	21785	Tff2	trefoil factor 2 (spasmolytic protein 1)	10090	MGI:1306805	Inparanoid, OMA, EggNOG
Rat	116592	Tff2	trefoil factor 2	10116	RGD:620709	Inparanoid, OMA, EggNOG
Dog	403489	TFF2	trefoil factor 2	9615	VGNC:47297	Inparanoid, OMA, EggNOG
Horse	100051351	TFF2	trefoil factor 2	9796	VGNC:24042	Inparanoid, OMA, EggNOG
Cow	616105	TFF2	trefoil factor 2	9913	VGNC:35791	Inparanoid, OMA, EggNOG
Pig	397420	TFF2	trefoil factor 2	9823		Inparanoid, OMA, EggNOG
Opossum	103100901	TFF2	trefoil factor 2	13616		Inparanoid, OMA, EggNOG
Chicken	418534	TFF2	trefoil factor 2	9031	CGNC:50784	Inparanoid, OMA, EggNOG
Anole lizard	107982585	LOC107982585	trefoil factor 2-like	28377		OMA, EggNOG
Xenopus	100496501	tff2	trefoil factor 2	8364	XB-GENE-5824118	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein / signaling molecule / peptide hormone / Trefoil factor 2
protein / signaling molecule / growth factor / Trefoil factor 2

DTO Classes
protein / Signaling / Growth factor / Trefoil factor 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]