Protein or Target Summary
Trefoil factor 3
| Gene ID | 7033 |
|---|---|
| uniprot | Q07654 |
| Gene Name | TFF3 |
| Ensernbl ID | ENSP00000430690 |
| Sequence | MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 7033 | TFF3 | Trefoil factor 3 | Q07654 |
| MOUSE | 21786 | Tff3 | Trefoil factor 3 | Q62395 |
| RAT | 25563 | Tff3 | Trefoil factor 3 | A0A0G2JSY6 |
| RAT | Tff3 | Trefoil factor 3 | A0A0G2K0R2 | |
| RAT | 25563 | Tff3 | Trefoil factor 3 | Q03191 |
Protein Classes
PANTHER Classes
protein / signaling molecule / peptide hormone / Trefoil factor 3
protein / signaling molecule / growth factor / Trefoil factor 3
protein / signaling molecule / peptide hormone / Trefoil factor 3
protein / signaling molecule / growth factor / Trefoil factor 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx