The store will not work correctly when cookies are disabled.
TFF3
| Description | Trefoil factor 3 |
|---|
Gene and Protein Information
| Gene ID | 7033 |
|---|
| Uniprot Accession IDs | A0A0A6YYJ4 E9PBB5 Q96NX0 Q9UDA5 |
|---|
| Ensembl ID | ENSP00000430690 |
|---|
| Symbol | ITF TFI ITF P1B TFI |
|---|
| Sequence | MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 474124 | TFF3 | trefoil factor 3 | 9598 | VGNC:1120 | OMA, EggNOG |
| Mouse | 21786 | Tff3 | trefoil factor 3, intestinal | 10090 | MGI:104638 | Inparanoid, OMA, EggNOG |
| Rat | 25563 | Tff3 | trefoil factor 3 | 10116 | RGD:3847 | Inparanoid, OMA, EggNOG |
| Dog | 403488 | TFF3 | trefoil factor 3 | 9615 | VGNC:47298 | Inparanoid, OMA, EggNOG |
| Horse | 100058018 | TFF3 | trefoil factor 3 | 9796 | VGNC:24043 | Inparanoid, OMA, EggNOG |
| Cow | 517889 | TFF3 | trefoil factor 3 | 9913 | VGNC:35792 | Inparanoid, OMA, EggNOG |
| Pig | 100627480 | TFF3 | trefoil factor 3 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | TFF3 | trefoil factor 3 [Source:HGNC Symbol;Acc:HGNC:11757] | 13616 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
