The store will not work correctly when cookies are disabled.
TXN2
| Description | Thioredoxin, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 25828 |
|---|
| Uniprot Accession IDs | Q5JZA0 Q6FH60 Q9UH29 MTRX |
|---|
| Ensembl ID | ENSP00000216185 |
|---|
| Symbol | TRX2 TXN MTRX TRX2 MT-TRX COXPD29 |
|---|
| Family | Belongs to the thioredoxin family. |
|---|
| Sequence | MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 56551 | Txn2 | thioredoxin 2 | 10090 | MGI:1929468 | Inparanoid, OMA, EggNOG |
| Rat | 79462 | Txn2 | thioredoxin 2 | 10116 | RGD:71040 | Inparanoid, OMA, EggNOG |
| Dog | 474519 | TXN2 | thioredoxin 2 | 9615 | VGNC:48009 | Inparanoid, OMA, EggNOG |
| Horse | 100069490 | TXN2 | thioredoxin 2 | 9796 | VGNC:24675 | Inparanoid, OMA, EggNOG |
| Cow | 281557 | TXN2 | thioredoxin 2 | 9913 | VGNC:36533 | Inparanoid, OMA, EggNOG |
| Pig | 100158080 | TXN2 | thioredoxin 2 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100024935 | TXN2 | thioredoxin 2 | 13616 | | OMA, EggNOG |
| Platypus | | TXN2 | thioredoxin 2 [Source:HGNC Symbol;Acc:HGNC:17772] | 9258 | | OMA, EggNOG |
| Anole lizard | 100555995 | txn2 | thioredoxin 2 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 493523 | txn2 | thioredoxin 2 | 8364 | XB-GENE-943373 | Inparanoid, OMA, EggNOG |
| Zebrafish | 402938 | txn2 | thioredoxin 2 | 7955 | ZDB-GENE-040426-1795 | Inparanoid, OMA, EggNOG |
| C. elegans | 179434 | trx-2 | Probable thioredoxin-2 | 6239 | | Inparanoid, OMA |
| Fruitfly | 38301 | CG8993 | CG8993 gene product from transcript CG8993-RA | 7227 | FBgn0035334 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
