The store will not work correctly when cookies are disabled.
Protein or Target Summary
Thioredoxin, mitochondrial
| Gene ID | 25828 |
|---|
| uniprot | Q99757 |
|---|
| Gene Name | TXN2 |
|---|
| Ensernbl ID | ENSP00000216185 |
|---|
| Family | Belongs to the thioredoxin family. |
|---|
| Sequence | MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 25828 | TXN2 | Thioredoxin, mitochondrial | Q99757 |
| MOUSE | | Txn2 | Thioredoxin, mitochondrial | A2A439 |
| MOUSE | | Txn2 | Thioredoxin, mitochondrial | G3UZY2 |
| MOUSE | | Txn2 | Thioredoxin, mitochondrial | G3UX99 |
| MOUSE | | Txn2 | Thioredoxin, mitochondrial | Q3TUS3 |
| MOUSE | 56551 | Txn2 | Thioredoxin, mitochondrial | P97493 |
| RAT | 79462 | Txn2 | Thioredoxin, mitochondrial | P97615 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
