Protein or Target Summary

Homeobox protein TGIF2

Gene ID	60436
uniprot	Q9GZN2
Gene Name	TGIF2
Ensernbl ID	ENSP00000362981
Family	Belongs to the TALE/TGIF homeobox family.
Sequence	MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	60436	TGIF2	Homeobox protein TGIF2	Q9GZN2
MOUSE		Tgif2	Homeobox protein TGIF2	H3BJF0
MOUSE	228839	Tgif2	Homeobox protein TGIF2	Q3TZS1
MOUSE	228839	Tgif2	TGFB-induced factor 2, isoform CRA_a	A2AVY9
MOUSE	228839	Tgif2	Homeobox protein TGIF2	Q8C0Y1
RAT	499929	Tgif2	RCG37402, isoform CRA_a	B5DEL6

Protein Classes

PANTHER Classes
protein / RNA binding protein / homeodomain transcription factor / Homeobox protein TGIF2
protein / RNA binding protein / DNA-directed RNA polymerase / Homeobox protein TGIF2

DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / Homeobox protein TGIF2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx