The store will not work correctly when cookies are disabled.
TXN
Gene and Protein Information
Gene ID | 7295 |
Uniprot Accession IDs | B1ALW1 O60744 Q53X69 Q96KI3 Q9UDG5 Trx |
Ensembl ID | ENSP00000363641 |
Symbol | TRDX TRX TRX1 TRX TRDX TRX1 |
Family | Belongs to the thioredoxin family. |
Sequence | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 740248 | TXN | thioredoxin | 9598 | VGNC:4894 | OMA, EggNOG |
Macaque | 712587 | TXN | thioredoxin | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 22166 | Txn1 | thioredoxin 1 | 10090 | MGI:98874 | Inparanoid, OMA, EggNOG |
Rat | 116484 | Txn1 | thioredoxin 1 | 10116 | RGD:621157 | OMA, EggNOG |
Horse | 100033827 | TXN | thioredoxin | 9796 | | Inparanoid, OMA, EggNOG |
Cow | 280950 | TXN | thioredoxin | 9913 | | Inparanoid, OMA, EggNOG |
Pig | 397581 | TXN | thioredoxin | 9823 | | Inparanoid, OMA, EggNOG |
Platypus | 100076650 | LOC100076650 | thioredoxin-like | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 396437 | TXN | thioredoxin | 9031 | CGNC:49804 | Inparanoid, OMA, EggNOG |
Anole lizard | 100560936 | LOC100560936 | thioredoxin | 28377 | | OMA, EggNOG |
Xenopus | 100170420 | loc100170420 | MGC80314 protein | 8364 | XB-GENE-5909791 | Inparanoid, OMA, EggNOG |
Zebrafish | 336637 | zgc:56493 | zgc:56493 | 7955 | ZDB-GENE-030131-8581 | Inparanoid, OMA, EggNOG |
C. elegans | 189905 | trx-4 | Thioredoxin | 6239 | | OMA, EggNOG |
S.cerevisiae | 850732 | TRX1 | thioredoxin TRX1 | 4932 | S000004033 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|