The store will not work correctly when cookies are disabled.
Protein or Target Summary
Mitochondrial import receptor subunit TOM22 homolog
| Gene ID | 56993 |
|---|
| uniprot | Q9NS69 |
|---|
| Gene Name | TOMM22 |
|---|
| Ensernbl ID | ENSP00000216034 |
|---|
| Family | Belongs to the Tom22 family. |
|---|
| Sequence | MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 56993 | TOMM22 | Mitochondrial import receptor subunit TOM22 homolog | Q9NS69 |
| MOUSE | | Tomm22 | Uncharacterized protein | Q3UBW3 |
| MOUSE | | Tomm22 | Mitochondrial import receptor subunit TOM22 homolog | A0A2R8VHM4 |
| MOUSE | | Tomm22 | Mitochondrial import receptor subunit TOM22 homolog | A0A2R8VHJ4 |
| MOUSE | 223696 | Tomm22 | Mitochondrial import receptor subunit TOM22 homolog | Q9CPQ3 |
| RAT | 300075 | Tomm22 | Mitochondrial import receptor subunit TOM22 homolog | Q75Q41 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
