The store will not work correctly when cookies are disabled.
Protein or Target Summary
Tumor necrosis factor receptor superfamily member 5
| Gene ID | 958 |
|---|
| uniprot | P25942 |
|---|
| Gene Name | CD40 |
|---|
| Ensernbl ID | ENSP00000361359 |
|---|
| Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 958 | CD40 | Tumor necrosis factor receptor superfamily member 5 | P25942 |
| MOUSE | | Cd40 | Tumor necrosis factor receptor superfamily member 5 | S4R2M8 |
| MOUSE | | Cd40 | Tumor necrosis factor receptor superfamily member 5 | A2A5L7 |
| MOUSE | 21939 | Cd40 | Tumor necrosis factor receptor superfamily member 5 | P27512 |
| RAT | 171369 | Cd40 | CD40 molecule | Q4QQW2 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
