The store will not work correctly when cookies are disabled.
PTP4A1
Description | Protein tyrosine phosphatase type IVA 1 |
---|
Gene and Protein Information
Gene ID | 7803 |
Uniprot Accession IDs | B2R6C8 O00648 Q49A54 |
Ensembl ID | ENSP00000359685 |
Symbol | PRL1 PTPCAAX1 HH72 PRL1 PRL-1 PTPCAAX1 PTP(CAAX1) |
Family | Belongs to the protein-tyrosine phosphatase family. |
Sequence | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Macaque | 716195 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9544 | | Inparanoid, OMA |
Mouse | 19243 | Ptp4a1 | protein tyrosine phosphatase 4a1 | 10090 | MGI:1277096 | Inparanoid, OMA, EggNOG |
Rat | 29463 | Ptp4a1 | protein tyrosine phosphatase type IVA, member 1 | 10116 | RGD:61970 | Inparanoid, OMA |
Dog | 481863 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9615 | | Inparanoid, OMA, EggNOG |
Horse | 100057042 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9796 | VGNC:22005 | Inparanoid, OMA, EggNOG |
Cow | 613326 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9913 | VGNC:33523 | Inparanoid, OMA |
Opossum | 100015403 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 13616 | | Inparanoid, OMA |
Platypus | 100073737 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9258 | | Inparanoid, OMA |
Chicken | 421877 | PTP4A1 | protein tyrosine phosphatase type IVA, member 1 | 9031 | CGNC:51557 | Inparanoid, OMA, EggNOG |
Anole lizard | 100560135 | ptp4a1 | protein tyrosine phosphatase type IVA, member 1 | 28377 | | Inparanoid, OMA, EggNOG |
Zebrafish | 493615 | ptp4a1 | protein tyrosine phosphatase type IVA, member 1 | 7955 | ZDB-GENE-041121-11 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|