The store will not work correctly when cookies are disabled.
Protein or Target Summary
Thy-1 membrane glycoprotein
| Gene ID | 7070 |
|---|
| uniprot | P04216 |
|---|
| Gene Name | THY1 |
|---|
| Ensernbl ID | ENSP00000284240 |
|---|
| Sequence | MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7070 | THY1 | Thy-1 membrane glycoprotein | P04216 |
| MOUSE | | Thy1 | Thy-1 membrane glycoprotein | A0A1L1SRS7 |
| MOUSE | | Thy1 | Thy-1 membrane glycoprotein | A0A1L1SUX8 |
| MOUSE | | Thy1 | CD90.1 | Q53YX2 |
| MOUSE | | Thy1 | Thy-1 membrane glycoprotein | A0A1L1ST40 |
| MOUSE | 21838 | Thy1 | Thy-1 membrane glycoprotein | P01831 |
| RAT | 24832 | Thy1 | Thy-1 membrane glycoprotein | P01830 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
