The store will not work correctly when cookies are disabled.
THY1
| Description | Thy-1 membrane glycoprotein |
|---|
Gene and Protein Information
| Gene ID | 7070 |
|---|
| Uniprot Accession IDs | Q16008 Q9NSP1 |
|---|
| Ensembl ID | ENSP00000284240 |
|---|
| Symbol | CD90 CDw90 |
|---|
| Sequence | MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451611 | THY1 | Thy-1 cell surface antigen | 9598 | VGNC:8275 | OMA, EggNOG |
| Macaque | 705321 | THY1 | Thy-1 cell surface antigen | 9544 | | Inparanoid, OMA |
| Mouse | 21838 | Thy1 | thymus cell antigen 1, theta | 10090 | MGI:98747 | Inparanoid, OMA, EggNOG |
| Rat | 24832 | Thy1 | Thy-1 cell surface antigen | 10116 | RGD:3860 | Inparanoid, OMA, EggNOG |
| Dog | 489365 | THY1 | Thy-1 cell surface antigen | 9615 | VGNC:47362 | Inparanoid, OMA, EggNOG |
| Horse | 100063377 | THY1 | Thy-1 cell surface antigen | 9796 | VGNC:24097 | Inparanoid, OMA, EggNOG |
| Cow | 614712 | THY1 | Thy-1 cell surface antigen | 9913 | VGNC:35856 | Inparanoid, OMA, EggNOG |
| Opossum | 100031120 | THY1 | Thy-1 cell surface antigen | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 378897 | THY1 | Thy-1 cell surface antigen | 9031 | CGNC:5094 | Inparanoid, OMA |
| Xenopus | 100101744 | thy1 | Thy-1 cell surface antigen | 8364 | XB-GENE-493820 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
