The store will not work correctly when cookies are disabled.
TMIGD2
| Description | Transmembrane and immunoglobulin domain-containing protein 2 |
|---|
Gene and Protein Information
| Gene ID | 126259 |
|---|
| Uniprot Accession IDs | Q6UW59 |
|---|
| Ensembl ID | ENSP00000301272 |
|---|
| Symbol | CD28H IGPR1 CD28H IGPR1 IGPR-1 |
|---|
| Sequence | MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGAPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737728 | TMIGD2 | transmembrane and immunoglobulin domain containing 2 | 9598 | VGNC:13096 | OMA, EggNOG |
| Horse | 100062939 | TMIGD2 | transmembrane and immunoglobulin domain containing 2 | 9796 | VGNC:52029 | Inparanoid, OMA, EggNOG |
| Cow | 524354 | TMIGD2 | transmembrane and immunoglobulin domain containing 2 | 9913 | VGNC:36133 | Inparanoid, OMA, EggNOG |
| Pig | 102164394 | TMIGD2 | transmembrane and immunoglobulin domain containing 2 | 9823 | | OMA, EggNOG |
| Opossum | 103093802 | TMIGD2 | transmembrane and immunoglobulin domain containing 2 | 13616 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
