The store will not work correctly when cookies are disabled.
Protein or Target Summary
Beta-galactoside alpha-2,6-sialyltransferase 1
| Gene ID | 6480 |
|---|
| uniprot | P15907 |
|---|
| Gene Name | ST6GAL1 |
|---|
| Ensernbl ID | ENSP00000169298 |
|---|
| Family | Belongs to the glycosyltransferase 29 family. |
|---|
| Sequence | MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6480 | ST6GAL1 | Beta-galactoside alpha-2,6-sialyltransferase 1 | P15907 |
| MOUSE | | St6gal1 | Sialyltransferase | Q9JJM6 |
| MOUSE | 20440 | St6gal1 | Uncharacterized protein | Q8BM62 |
| MOUSE | | St6gal1 | Beta-galactoside alpha-2,6-sialyltransferase 1 | D3Z1Z5 |
| MOUSE | 20440 | St6gal1 | Beta-galactoside alpha-2,6-sialyltransferase 1 | Q64685 |
| RAT | 25197 | St6gal1 | Beta-galactoside alpha-2,6-sialyltransferase 1 | F2Z3S3 |
| RAT | 25197 | St6gal1 | Beta-galactoside alpha-2,6-sialyltransferase 1 | G3V680 |
| RAT | 25197 | St6gal1 | Beta-galactoside alpha-2,6-sialyltransferase 1 | P13721 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
