JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
SCGN

SCGN

Description	Secretagogin

Gene and Protein Information

Gene ID	10590
Uniprot Accession IDs	A8K0B2 Q5VV44 Q96QV7 Q9UJF6
Ensembl ID	ENSP00000367197
Symbol	SECRET SEGN CALBL SECRET setagin DJ501N12.8
Sequence	MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	462485	SCGN	secretagogin, EF-hand calcium binding protein	9598	VGNC:3695	OMA, EggNOG
Macaque	694072	SCGN	secretagogin, EF-hand calcium binding protein	9544		Inparanoid, OMA
Mouse	214189	Scgn	secretagogin, EF-hand calcium binding protein	10090	MGI:2384873	Inparanoid, OMA, EggNOG
Rat	306942	Scgn	secretagogin, EF-hand calcium binding protein	10116	RGD:1303281	Inparanoid, OMA, EggNOG
Dog	610954	SCGN	secretagogin, EF-hand calcium binding protein	9615	VGNC:45909	Inparanoid, OMA, EggNOG
Horse	100067986	SCGN	secretagogin, EF-hand calcium binding protein	9796	VGNC:22725	Inparanoid, OMA, EggNOG
Cow	618206	SCGN	secretagogin, EF-hand calcium binding protein	9913	VGNC:34337	Inparanoid, OMA, EggNOG
Pig	768111	SCGN	secretagogin, EF-hand calcium binding protein	9823		Inparanoid, OMA, EggNOG
Opossum		SCGN	secretagogin, EF-hand calcium binding protein [Source:HGNC Symbol;Acc:HGNC:16941]	13616		Inparanoid, OMA, EggNOG
Platypus	100087054	SCGN	secretagogin, EF-hand calcium binding protein	9258		Inparanoid, OMA, EggNOG
Chicken	421001	SCGN	secretagogin, EF-hand calcium binding protein	9031	CGNC:10196	Inparanoid, OMA, EggNOG
Anole lizard	100566868	scgn	secretagogin, EF-hand calcium binding protein	28377		Inparanoid, OMA, EggNOG
Xenopus	780242	scgn	secretagogin, EF-hand calcium binding protein	8364	XB-GENE-988344	Inparanoid, OMA, EggNOG
Zebrafish	573010	scgn	secretagogin, EF-hand calcium binding protein	7955	ZDB-GENE-041010-82	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

Name	Specifications	Species reactivity	Application	Availability	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]