The store will not work correctly when cookies are disabled.
SHBG
| Description | Sex hormone-binding globulin |
|---|
Gene and Protein Information
| Gene ID | 6462 |
|---|
| Uniprot Accession IDs | B0FWH4 E9PGW1 F5H5Z8 I3L1N7 P14689 Q16616 Q3MIL0 Q6ISD2 SHBG |
|---|
| Ensembl ID | ENSP00000369816 |
|---|
| Symbol | ABP SBP TEBG |
|---|
| Sequence | MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 455215 | SHBG | sex hormone binding globulin | 9598 | VGNC:9607 | OMA, EggNOG |
| Macaque | 716004 | SHBG | sex hormone binding globulin | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20415 | Shbg | sex hormone binding globulin | 10090 | MGI:98295 | Inparanoid, OMA, EggNOG |
| Rat | 24775 | Shbg | sex hormone binding globulin | 10116 | RGD:3671 | Inparanoid, OMA, EggNOG |
| Dog | 100856157 | SHBG | sex hormone binding globulin | 9615 | VGNC:46139 | Inparanoid, OMA, EggNOG |
| Horse | 100073011 | SHBG | sex hormone binding globulin | 9796 | VGNC:22954 | Inparanoid, OMA, EggNOG |
| Cow | 404182 | SHBG | sex hormone binding globulin | 9913 | VGNC:34589 | Inparanoid, OMA, EggNOG |
| Opossum | 100015497 | SHBG | sex hormone binding globulin | 13616 | | Inparanoid, OMA, EggNOG |
| Zebrafish | 322604 | shbg | sex hormone-binding globulin | 7955 | ZDB-GENE-030131-1324 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
