The store will not work correctly when cookies are disabled.
DUSP5
| Description | Dual specificity protein phosphatase 5 |
|---|
Gene and Protein Information
| Gene ID | 1847 |
|---|
| Uniprot Accession IDs | Q12997 Q5T603 |
|---|
| Ensembl ID | ENSP00000358596 |
|---|
| Symbol | VH3 DUSP HVH3 |
|---|
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. |
|---|
| Sequence | MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECCVDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 240672 | Dusp5 | dual specificity phosphatase 5 | 10090 | MGI:2685183 | Inparanoid, OMA, EggNOG |
| Rat | 171109 | Dusp5 | dual specificity phosphatase 5 | 10116 | RGD:620854 | Inparanoid, OMA, EggNOG |
| Dog | 486884 | DUSP5 | dual specificity phosphatase 5 | 9615 | VGNC:40134 | Inparanoid, OMA, EggNOG |
| Horse | 100068966 | DUSP5 | dual specificity phosphatase 5 | 9796 | VGNC:17357 | Inparanoid, OMA, EggNOG |
| Cow | 507061 | DUSP5 | dual specificity phosphatase 5 | 9913 | VGNC:28261 | Inparanoid, OMA, EggNOG |
| Opossum | 100028017 | DUSP5 | dual specificity phosphatase 5 | 13616 | | Inparanoid, EggNOG |
| Platypus | 100082126 | DUSP5 | dual specificity phosphatase 5 | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557549 | dusp5 | dual specificity phosphatase 5 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 548573 | dusp5 | dual specificity phosphatase 5 | 8364 | XB-GENE-957572 | Inparanoid, OMA, EggNOG |
| Zebrafish | 114436 | dusp5 | dual specificity phosphatase 5 | 7955 | ZDB-GENE-010625-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
