The store will not work correctly when cookies are disabled.
SST
Gene and Protein Information
| Gene ID | 6750 |
|---|
| Uniprot Accession IDs | B2R5G3 P01166 |
|---|
| Ensembl ID | ENSP00000287641 |
|---|
| Symbol | SMST |
|---|
| Family | Belongs to the somatostatin family. |
|---|
| Sequence | MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 708626 | SST | somatostatin | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20604 | Sst | somatostatin | 10090 | MGI:98326 | Inparanoid, OMA, EggNOG |
| Rat | 24797 | Sst | somatostatin | 10116 | RGD:3761 | Inparanoid, OMA, EggNOG |
| Dog | 403993 | SST | somatostatin | 9615 | VGNC:46842 | Inparanoid, OMA, EggNOG |
| Horse | 100059610 | SST | somatostatin | 9796 | VGNC:23619 | Inparanoid, OMA, EggNOG |
| Cow | 280932 | SST | somatostatin | 9913 | VGNC:35324 | Inparanoid, OMA, EggNOG |
| Opossum | 100009770 | SST | somatostatin | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100082220 | SST | somatostatin | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 396279 | SST | somatostatin | 9031 | CGNC:5562 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100561399 | sst | somatostatin | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100037904 | sst | somatostatin | 8364 | XB-GENE-491021 | Inparanoid, OMA, EggNOG |
| Zebrafish | 326018 | sst1.1 | somatostatin 1, tandem duplicate 1 | 7955 | ZDB-GENE-030131-4743 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
