GFRAL

DescriptionGDNF family receptor alpha-like

Gene and Protein Information

Gene ID389400
Uniprot Accession IDs Q5VTF6
Ensembl ID ENSP00000343636
Symbol C6orf144 GRAL UNQ9356 C6orf144 bA360D14.1
FamilyBelongs to the GDNFR family.
Sequence
MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp743306GFRALGDNF family receptor alpha like9598VGNC:2838OMA, EggNOG
Mouse404194GfralGDNF family receptor alpha like10090MGI:3607786Inparanoid, OMA, EggNOG
Rat501023GfralGDNF family receptor alpha like10116RGD:1565220Inparanoid, OMA, EggNOG
Dog481851GFRALGDNF family receptor alpha like9615VGNC:41192Inparanoid, OMA, EggNOG
Horse100069686GFRALGDNF family receptor alpha like9796VGNC:18319Inparanoid, OMA, EggNOG
Cow531956GFRALGDNF family receptor alpha like9913VGNC:53972Inparanoid, OMA, EggNOG
Pig100521501GFRALGDNF family receptor alpha like9823Inparanoid, OMA, EggNOG
Chicken421887GFRALGDNF family receptor alpha like9031CGNC:12187OMA, EggNOG
Anole lizardGFRALGDNF family receptor alpha like [Source:HGNC Symbol;Acc:HGNC:32789]28377Inparanoid, OMA, EggNOG
Zebrafish561326gfralGDNF family receptor alpha like7955ZDB-GENE-110607-2OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source