The store will not work correctly when cookies are disabled.
Protein or Target Summary
GDNF family receptor alpha-like
| Gene ID | 389400 |
|---|
| uniprot | Q6UXV0 |
|---|
| Gene Name | GFRAL |
|---|
| Ensernbl ID | ENSP00000343636 |
|---|
| Family | Belongs to the GDNFR family. |
|---|
| Sequence | MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 389400 | GFRAL | GDNF family receptor alpha-like | Q6UXV0 |
| MOUSE | 404194 | Gfral | GDNF family receptor alpha-like | Q6SJE0 |
| RAT | 501023 | Gfral | GDNF family receptor alpha-like | D3ZB94 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
