SIRT4
| Description | NAD-dependent protein lipoamidase sirtuin-4, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 23409 |
|---|---|
| Uniprot Accession IDs | O43346 Q32M33 |
| Ensembl ID | ENSP00000202967 |
| Symbol | SIR2L4 SIR2L4 |
| Family | Belongs to the sirtuin family. Class II subfamily. |
| Sequence | MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742235 | SIRT4 | sirtuin 4 | 9598 | VGNC:13444 | OMA, EggNOG |
| Mouse | 75387 | Sirt4 | sirtuin 4 | 10090 | MGI:1922637 | Inparanoid, OMA, EggNOG |
| Rat | 304539 | Sirt4 | sirtuin 4 | 10116 | RGD:1310413 | Inparanoid, OMA, EggNOG |
| Dog | 477507 | SIRT4 | sirtuin 4 | 9615 | VGNC:46185 | Inparanoid, OMA, EggNOG |
| Horse | 100053520 | SIRT4 | sirtuin 4 | 9796 | VGNC:22989 | Inparanoid, OMA, EggNOG |
| Cow | 519328 | SIRT4 | sirtuin 4 | 9913 | VGNC:34633 | Inparanoid, OMA, EggNOG |
| Pig | 100125349 | SIRT4 | sirtuin 4 | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100088272 | SIRT4 | sirtuin 4 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 416981 | SIRT4 | sirtuin 4 | 9031 | CGNC:5474 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555746 | sirt4 | sirtuin 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 733911 | sirt4 | sirtuin 4 | 8364 | XB-GENE-948981 | Inparanoid, OMA, EggNOG |
| Zebrafish | 791628 | sirt4 | sirtuin 4 | 7955 | ZDB-GENE-041010-65 | OMA, EggNOG |
| C. elegans | 181455 | sir-2.2 | NAD-dependent protein deacylase sir-2.2 | 6239 | OMA, EggNOG | |
| C. elegans | 185876 | sir-2.3 | NAD-dependent protein deacylase sir-2.3 | 6239 | Inparanoid, OMA | |
| Fruitfly | 31480 | Sirt4 | Sirtuin 4 | 7227 | FBgn0029783 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / hydrolase / deacetylase / NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
protein / hydrolase / chromatin/chromatin-binding protein / NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
protein / hydrolase / deacetylase / NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
protein / hydrolase / chromatin/chromatin-binding protein / NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
DTO Classes
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class III / NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class III / NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|