The store will not work correctly when cookies are disabled.
Protein or Target Summary
Secreted frizzled-related protein 1
| Gene ID | 6422 |
|---|
| uniprot | Q8N474 |
|---|
| Gene Name | SFRP1 |
|---|
| Ensernbl ID | ENSP00000220772 |
|---|
| Family | Belongs to the secreted frizzled-related protein (sFRP) family. |
|---|
| Sequence | MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6422 | SFRP1 | Secreted frizzled-related protein 1 | Q8N474 |
| MOUSE | 20377 | Sfrp1 | Secreted frizzled-related protein 1 | Q8C4U3 |
| RAT | 84402 | Sfrp1 | Secreted frizzled-related protein 1 | F1LLX7 |
| RAT | | Sfrp1 | Secreted frizzled-related protein 1 | Q9R168 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
