The store will not work correctly when cookies are disabled.
Protein or Target Summary
Sigma non-opioid intracellular receptor 1
| Gene ID | 10280 |
|---|
| uniprot | Q99720 |
|---|
| Gene Name | SIGMAR1 |
|---|
| Ensernbl ID | ENSP00000277010 |
|---|
| Family | Belongs to the ERG2 family. |
|---|
| Sequence | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10280 | SIGMAR1 | Sigma non-opioid intracellular receptor 1 | Q99720 |
| MOUSE | 18391 | Sigmar1 | Sigma 1 receptor variant SR-1E | B7ZJH9 |
| MOUSE | 18391 | Sigmar1 | Sigma 1 receptor variant SR-1B | B7ZJH6 |
| MOUSE | 18391 | Sigmar1 | Sigma-1 receptor short form | I4DCY6 |
| MOUSE | 18391 | Sigmar1 | Sigma 1 receptor variant SR-1C | B7ZJH7 |
| MOUSE | 18391 | Sigmar1 | Sigma 1 receptor variant SR-1A | A2AMS0 |
| MOUSE | 18391 | Sigmar1 | Sigma 1 receptor variant SR-1D | B7ZJH8 |
| MOUSE | 18391 | Sigmar1 | Sigma non-opioid intracellular receptor 1 | O55242 |
| RAT | 29336 | Sigmar1 | Sigma non-opioid intracellular receptor 1 | Q9R0C9 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
