The store will not work correctly when cookies are disabled.
SIGMAR1
| Description | Sigma non-opioid intracellular receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 10280 |
|---|
| Uniprot Accession IDs | D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 |
|---|
| Ensembl ID | ENSP00000277010 |
|---|
| Symbol | OPRS1 SRBP SRBP ALS16 DSMA2 OPRS1 SR-BP SIG-1R SR-BP1 sigma1R hSigmaR1 |
|---|
| Family | Belongs to the ERG2 family. |
|---|
| Sequence | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 465062 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9598 | VGNC:10120 | OMA, EggNOG |
| Macaque | 700469 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18391 | Sigmar1 | sigma non-opioid intracellular receptor 1 | 10090 | MGI:1195268 | Inparanoid, OMA, EggNOG |
| Rat | 29336 | Sigmar1 | sigma non-opioid intracellular receptor 1 | 10116 | RGD:68364 | Inparanoid, OMA, EggNOG |
| Dog | 481587 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9615 | VGNC:46170 | Inparanoid, OMA, EggNOG |
| Horse | | SIGMAR1 | sigma non-opioid intracellular receptor 1 [Source:HGNC Symbol;Acc:HGNC:8157] | 9796 | | OMA, EggNOG |
| Cow | 538903 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9913 | VGNC:34619 | Inparanoid, OMA, EggNOG |
| Opossum | 100028812 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 100859748 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9031 | CGNC:63401 | Inparanoid, OMA |
| Anole lizard | 100551557 | sigmar1 | sigma non-opioid intracellular receptor 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Zebrafish | 393952 | sigmar1 | sigma non-opioid intracellular receptor 1 | 7955 | ZDB-GENE-040426-1006 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 855242 | ERG2 | C-8 sterol isomerase ERG2 | 4932 | S000004815 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
