The store will not work correctly when cookies are disabled.
TSNAX
| Description | Translin-associated protein X |
|---|
Gene and Protein Information
| Gene ID | 7257 |
|---|
| Uniprot Accession IDs | B1APC6 |
|---|
| Ensembl ID | ENSP00000355599 |
|---|
| Symbol | TRAX C3PO TRAX |
|---|
| Family | Belongs to the translin family. |
|---|
| Sequence | MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 457819 | TSNAX | translin associated factor X | 9598 | VGNC:10919 | OMA, EggNOG |
| Macaque | 713347 | TSNAX | translin associated factor X | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 53424 | Tsnax | translin-associated factor X | 10090 | MGI:1855672 | Inparanoid, OMA, EggNOG |
| Rat | 64028 | Tsnax | translin-associated factor X | 10116 | RGD:621574 | Inparanoid, OMA, EggNOG |
| Dog | 479203 | TSNAX | translin associated factor X | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100060520 | TSNAX | translin associated factor X | 9796 | VGNC:51812 | Inparanoid, OMA, EggNOG |
| Cow | 533927 | TSNAX | translin associated factor X | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100156036 | TSNAX | translin associated factor X | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100021903 | TSNAX | translin associated factor X | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566407 | tsnax | translin associated factor X | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 448467 | tsnax | translin-associated factor X | 8364 | XB-GENE-947707 | Inparanoid, OMA, EggNOG |
| Zebrafish | 556657 | tsnax | translin-associated factor X | 7955 | ZDB-GENE-050913-80 | Inparanoid, OMA |
| Fruitfly | 41871 | Trax | Translin associated factor X | 7227 | FBgn0038327 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
