JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Tumor necrosis factor receptor superfamily member 8

Gene ID	943
uniprot	P28908
Gene Name	TNFRSF8
Ensernbl ID	ENSP00000263932
Sequence	MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	943	TNFRSF8	Tumor necrosis factor receptor superfamily member 8	P28908
MOUSE	21941	Tnfrsf8	Tumor necrosis factor receptor superfamily, member 8	A1L3C9
MOUSE		Tnfrsf8	Tumor necrosis factor receptor superfamily member 8	D6RHK4
MOUSE	21941	Tnfrsf8	Tumor necrosis factor receptor superfamily member 8	Q60846
RAT		Tnfrsf8	Tumor necrosis factor receptor superfamily member 8	F1LNN5
RAT		Tnfrsf8	Tumor necrosis factor receptor superfamily member 8	A0A0G2K7Z6
RAT	25069	Tnfrsf8	Tumor necrosis factor receptor superfamily member 8	P97525

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx