The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
TNFRSF8
| Description | Tumor necrosis factor receptor superfamily member 8 |
|---|
Gene and Protein Information
| Gene ID | 943 |
|---|
| Uniprot Accession IDs | P28908 B1AN79 B9EGD9 D3YTD8 Q6P4D9 |
|---|
| Ensembl ID | ENSP00000263932 |
|---|
| Symbol | CD30 D1S166E CD30 Ki-1 D1S166E |
|---|
| Sequence | MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 457960 | TNFRSF8 | TNF receptor superfamily member 8 | 9598 | VGNC:7012 | OMA, EggNOG |
| Macaque | 722773 | TNFRSF8 | TNF receptor superfamily member 8 | 9544 | | OMA, EggNOG |
| Mouse | 21941 | Tnfrsf8 | tumor necrosis factor receptor superfamily, member 8 | 10090 | MGI:99908 | Inparanoid, OMA, EggNOG |
| Rat | 25069 | Tnfrsf8 | TNF receptor superfamily member 8 | 10116 | RGD:3879 | Inparanoid, OMA, EggNOG |
| Dog | 487438 | TNFRSF8 | TNF receptor superfamily member 8 | 9615 | VGNC:47667 | Inparanoid, OMA, EggNOG |
| Horse | 100055885 | TNFRSF8 | TNF receptor superfamily member 8 | 9796 | VGNC:24373 | Inparanoid, OMA, EggNOG |
| Cow | 614780 | TNFRSF8 | TNF receptor superfamily member 8 | 9913 | VGNC:36170 | Inparanoid, OMA, EggNOG |
| Pig | 100737399 | TNFRSF8 | TNF receptor superfamily member 8 | 9823 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
The page will load shortly, Thanks for your patience!
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!
