Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

TNFRSF8

DescriptionTumor necrosis factor receptor superfamily member 8

Gene and Protein Information

Gene ID943
Uniprot Accession IDs P28908 B1AN79 B9EGD9 D3YTD8 Q6P4D9
Ensembl ID ENSP00000263932
Symbol CD30 D1S166E CD30 Ki-1 D1S166E
Sequence
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457960TNFRSF8TNF receptor superfamily member 89598VGNC:7012OMA, EggNOG
Macaque722773TNFRSF8TNF receptor superfamily member 89544OMA, EggNOG
Mouse21941Tnfrsf8tumor necrosis factor receptor superfamily, member 810090MGI:99908Inparanoid, OMA, EggNOG
Rat25069Tnfrsf8TNF receptor superfamily member 810116RGD:3879Inparanoid, OMA, EggNOG
Dog487438TNFRSF8TNF receptor superfamily member 89615VGNC:47667Inparanoid, OMA, EggNOG
Horse100055885TNFRSF8TNF receptor superfamily member 89796VGNC:24373Inparanoid, OMA, EggNOG
Cow614780TNFRSF8TNF receptor superfamily member 89913VGNC:36170Inparanoid, OMA, EggNOG
Pig100737399TNFRSF8TNF receptor superfamily member 89823OMA, EggNOG

Associated Recombinant Proteins

The page will load shortly, Thanks for your patience!
NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!