JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Tax1-binding protein 3

Gene ID	30851
uniprot	O14907
Gene Name	TAX1BP3
Ensernbl ID	ENSP00000225525
Sequence	MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	30851	TAX1BP3	Tax1-binding protein 3	O14907
MOUSE		Tax1bp3	Tax1-binding protein 3	B1AUD9
MOUSE	76281	Tax1bp3	Tax1-binding protein 3	Q9DBG9
RAT	360564	Tax1bp3	Tax1-binding protein 3	A0A1W2Q5Z6
RAT	360564	Tax1bp3	Tax1-binding protein 3	Q4QQV1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx