The store will not work correctly when cookies are disabled.
Protein or Target Summary
Phenylethanolamine N-methyltransferase
| Gene ID | 5409 |
|---|
| uniprot | P11086 |
|---|
| Gene Name | PNMT |
|---|
| Ensernbl ID | ENSP00000269582 |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family. |
|---|
| Sequence | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5409 | PNMT | Phenylethanolamine N-methyltransferase | P11086 |
| MOUSE | 18948 | Pnmt | Phenylethanolamine-N-methyltransferase | Q0VB50 |
| MOUSE | 18948 | Pnmt | Phenylethanolamine N-methyltransferase | P40935 |
| RAT | | Pnmt | Phenylethanolamine N-methyltransferase | M0RCR5 |
| RAT | 24661 | Pnmt | Phenylethanolamine N-methyltransferase | P10937 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
