The store will not work correctly when cookies are disabled.
PNMT
| Description | Phenylethanolamine N-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 5409 |
|---|
| Uniprot Accession IDs | PNMTase |
|---|
| Ensembl ID | ENSP00000269582 |
|---|
| Symbol | PENT PENT PNMTase |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family. |
|---|
| Sequence | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 454634 | PNMT | phenylethanolamine N-methyltransferase | 9598 | VGNC:9531 | OMA, EggNOG |
| Mouse | 18948 | Pnmt | phenylethanolamine-N-methyltransferase | 10090 | MGI:97724 | Inparanoid, OMA, EggNOG |
| Rat | 24661 | Pnmt | phenylethanolamine-N-methyltransferase | 10116 | RGD:3361 | Inparanoid, OMA, EggNOG |
| Dog | 491023 | PNMT | phenylethanolamine N-methyltransferase | 9615 | VGNC:49943 | Inparanoid, OMA, EggNOG |
| Horse | 100033859 | PNMT | phenylethanolamine N-methyltransferase | 9796 | VGNC:21629 | Inparanoid, OMA, EggNOG |
| Cow | 281413 | PNMT | phenylethanolamine N-methyltransferase | 9913 | VGNC:33086 | Inparanoid, OMA, EggNOG |
| Pig | 100144479 | PNMT | phenylethanolamine N-methyltransferase | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100017260 | PNMT | phenylethanolamine N-methyltransferase | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | PNMT | phenylethanolamine N-methyltransferase [Source:HGNC Symbol;Acc:HGNC:9160] | 9258 | | OMA, EggNOG |
| Anole lizard | 100565710 | pnmt | phenylethanolamine N-methyltransferase | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | | pnmt | phenylethanolamine N-methyltransferase [Source:Xenbase;Acc:XB-GENE-962104] | 8364 | | OMA, EggNOG |
| C. elegans | 175868 | anmt-2 | Amine N-MethylTransferase | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
