Protein or Target Summary
Prostaglandin E2 receptor EP2 subtype
Gene ID | 5732 |
---|---|
uniprot | P43116 |
Gene Name | PTGER2 |
Ensernbl ID | ENSP00000245457 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 5732 | PTGER2 | Prostaglandin E2 receptor EP2 subtype | P43116 |
MOUSE | Ptger2 | Uncharacterized protein | Q3UW60 | |
MOUSE | 19217 | Ptger2 | Prostaglandin E receptor 2 (Subtype EP2) | Q543A9 |
MOUSE | 19217 | Ptger2 | Prostaglandin E2 receptor EP2 subtype | Q62053 |
RAT | 81752 | Ptger2 | Prostaglandin E2 receptor EP2 subtype | Q62928 |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Prostaglandin E2 receptor EP2 subtype
protein / receptor / G-protein coupled receptor / Prostaglandin E2 receptor EP2 subtype
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Prostaglandin E2 receptor EP2 subtype
protein / G-protein coupled receptor / Class A rhodopsin like / Prostaglandin E2 receptor EP2 subtype
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx