Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

PTGER2

DescriptionProstaglandin E2 receptor EP2 subtype

Gene and Protein Information

Gene ID5732
Uniprot Accession IDs D3DSC0 Q52LG8 PGE receptor EP2 subtype
Ensembl ID ENSP00000245457
Symbol EP2
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467459PTGER2prostaglandin E receptor 29598VGNC:3332OMA, EggNOG
Macaque708024PTGER2prostaglandin E receptor 29544Inparanoid, OMA, EggNOG
Mouse19217Ptger2prostaglandin E receptor 2 (subtype EP2)10090MGI:97794Inparanoid, OMA, EggNOG
Rat81752Ptger2prostaglandin E receptor 210116RGD:620020Inparanoid, OMA, EggNOG
Dog403797PTGER2prostaglandin E receptor 29615VGNC:45143Inparanoid, OMA, EggNOG
Horse100067279PTGER2prostaglandin E receptor 29796VGNC:21987Inparanoid, OMA, EggNOG
Cow282329PTGER2prostaglandin E receptor 29913VGNC:33502Inparanoid, OMA, EggNOG
PigPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9823OMA, EggNOG
Opossum100015803PTGER2prostaglandin E receptor 213616Inparanoid, EggNOG
PlatypusPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]9258OMA, EggNOG
Anole lizardPTGER2prostaglandin E receptor 2 [Source:HGNC Symbol;Acc:HGNC:9594]28377Inparanoid, OMA, EggNOG
Xenopus100493226ptger2prostaglandin E receptor 28364XB-GENE-967341Inparanoid, OMA, EggNOG
Zebrafish570410ptger2bprostaglandin E receptor 2b (subtype EP2)7955ZDB-GENE-040724-267Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Prostaglandin E2 receptor EP2 subtype
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Prostaglandin E2 receptor EP2 subtype

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.