Protein or Target Summary
Prostaglandin E2 receptor EP2 subtype
| Gene ID | 5732 |
|---|---|
| uniprot | P43116 |
| Gene Name | PTGER2 |
| Ensernbl ID | ENSP00000245457 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5732 | PTGER2 | Prostaglandin E2 receptor EP2 subtype | P43116 |
| MOUSE | Ptger2 | Uncharacterized protein | Q3UW60 | |
| MOUSE | 19217 | Ptger2 | Prostaglandin E receptor 2 (Subtype EP2) | Q543A9 |
| MOUSE | 19217 | Ptger2 | Prostaglandin E2 receptor EP2 subtype | Q62053 |
| RAT | 81752 | Ptger2 | Prostaglandin E2 receptor EP2 subtype | Q62928 |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Prostaglandin E2 receptor EP2 subtype
protein / receptor / G-protein coupled receptor / Prostaglandin E2 receptor EP2 subtype
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Prostaglandin E2 receptor EP2 subtype
protein / G-protein coupled receptor / Class A rhodopsin like / Prostaglandin E2 receptor EP2 subtype
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx