The store will not work correctly when cookies are disabled.
PSENEN
| Description | Gamma-secretase subunit PEN-2 |
|---|
Gene and Protein Information
| Gene ID | 55851 |
|---|
| Uniprot Accession IDs | B2R5L9 |
|---|
| Ensembl ID | ENSP00000468411 |
|---|
| Symbol | PEN2 PEN2 PEN-2 MDS033 ACNINV2 MSTP064 |
|---|
| Family | Belongs to the PEN-2 family. |
|---|
| Sequence | MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 455962 | PSENEN | presenilin enhancer gamma-secretase subunit | 9598 | | OMA, EggNOG |
| Mouse | 66340 | Psenen | presenilin enhancer gamma secretase subunit | 10090 | MGI:1913590 | Inparanoid, OMA, EggNOG |
| Rat | 292788 | Psenen | presenilin enhancer gamma secretase subunit | 10116 | RGD:1312037 | Inparanoid, OMA |
| Dog | 476479 | PSENEN | presenilin enhancer, gamma-secretase subunit | 9615 | VGNC:53755 | Inparanoid, OMA, EggNOG |
| Horse | 100051536 | PSENEN | presenilin enhancer, gamma-secretase subunit | 9796 | VGNC:51066 | OMA, EggNOG |
| Cow | 493993 | PSENEN | presenilin enhancer gamma-secretase subunit | 9913 | | Inparanoid, OMA, EggNOG |
| Opossum | 100016311 | PSENEN | presenilin enhancer gamma-secretase subunit | 13616 | | OMA, EggNOG |
| Anole lizard | 100560078 | psenen | presenilin enhancer gamma-secretase subunit | 28377 | | OMA, EggNOG |
| Xenopus | 549090 | psenen | presenilin enhancer, gamma-secretase subunit | 8364 | XB-GENE-854651 | Inparanoid, OMA, EggNOG |
| Zebrafish | 402810 | psenen | presenilin enhancer, gamma-secretase subunit | 7955 | ZDB-GENE-040218-1 | Inparanoid, OMA, EggNOG |
| C. elegans | 176565 | pen-2 | Gamma-secretase subunit pen-2 | 6239 | | OMA, EggNOG |
| Fruitfly | 251430 | pen-2 | presenilin enhancer | 7227 | FBgn0053198 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
