The store will not work correctly when cookies are disabled.
PRDX4
Description | Peroxiredoxin-4 |
---|
Gene and Protein Information
Gene ID | 10549 |
Uniprot Accession IDs | Q6FHT3 |
Ensembl ID | ENSP00000368646 |
Symbol | PRX-4 AOE372 AOE37-2 HEL-S-97n |
Family | Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily. |
Sequence | MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Macaque | 697635 | PRDX4 | peroxiredoxin 4 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 53381 | Prdx4 | peroxiredoxin 4 | 10090 | MGI:1859815 | Inparanoid, EggNOG |
Rat | 85274 | Prdx4 | peroxiredoxin 4 | 10116 | RGD:620043 | Inparanoid, OMA, EggNOG |
Dog | 100856588 | PRDX4 | peroxiredoxin 4 | 9615 | VGNC:44952 | Inparanoid, OMA, EggNOG |
Horse | 100059985 | PRDX4 | peroxiredoxin 4 | 9796 | VGNC:21820 | Inparanoid, OMA, EggNOG |
Cow | 281999 | PRDX4 | peroxiredoxin 4 | 9913 | VGNC:33302 | Inparanoid, OMA, EggNOG |
Pig | 100152260 | PRDX4 | peroxiredoxin 4 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100012181 | PRDX4 | peroxiredoxin 4 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | | PRDX4 | peroxiredoxin 4 [Source:HGNC Symbol;Acc:HGNC:17169] | 9258 | | OMA, EggNOG |
Chicken | 418601 | PRDX4 | peroxiredoxin 4 | 9031 | CGNC:12239 | Inparanoid, OMA, EggNOG |
Anole lizard | 100553113 | prdx4 | peroxiredoxin 4 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 448526 | prdx4 | peroxiredoxin 4 | 8364 | XB-GENE-976761 | Inparanoid, OMA, EggNOG |
Zebrafish | 570477 | prdx4 | peroxiredoxin 4 | 7955 | ZDB-GENE-030131-1096 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|