| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155948-10mg | 10mg | In stock | $129.90 | |
| rp155948-50mg | 50mg | In stock | $199.90 | |
| rp155948-200mg | 200mg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $459.90 | |
| rp155948-1g | 1g | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,299.90 |
GMP, ≥95%(RP-HPLC&SDS-PAGE), Oryza sativa, No tag, 20-698 aa
| Product Name | Recombinant Human Transferrin Protein , ≥95%(RP-HPLC), high purity, CAS No.11096-37-0 |
|---|---|
| Synonyms | protirelin|24305-27-9|Thyroliberin|Lopremone|Synthetic TRH|Rifathyroin|Thypinone|Thyrotropin-releasing factor|TSH-releasing factor|Thyrotropic-releasing factor|5-Oxo-L-prolyl-L-histidyl-L-prolinamide|TRH|11096-37-0|ABBOTT-38579|Abbott 38579|Relefact TRH|S |
| Grade | Azide Free, Carrier Free, GMP, Low Endotoxin |
| Product Description | Purity ≥95% RP-HPLC Transferrin is a major iron-binding and cell-transporting molecule found in serum. Serum-free cell culture systems require a form of iron delivery. Transferrin is the preferred delivery form of iron because the cell can process transferrin bound iron in a physiologically appropriate manner via transferrin receptors on the cell surface. This product is a recombinant human transferrin derived from rice endosperm cells, which is mainly used in cell culture. Compared with bovine transferrin, this product avoids the risk of contamination from human or animal viruses and mycoplasma. |
| Specifications & Purity | GMP, Carrier Free, Low Endotoxin, Azide Free, ≥95%(RP-HPLC&SDS-PAGE) |
| Purity | ≥95%(RP-HPLC) |
| Endotoxin Concentration | ≤1EU/mg |
| Expression System | Oryza sativa |
| Species | Human |
| Amino Acids | 20-698 aa |
| Sequence | VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARS |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P02787 |
| Source | Recombinant |
| Predicted molecular weight | 75.19 kDa |
| ALogP | -2.5 |
|---|
Recombinant Human Transferrin Protein (rp155948)-SDS-PAGE
2μg/lane of Recombinant Human EGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 69.4 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstituted with sterile PBS and stored at 4℃ for 1 month. Use as soon as possible. |
| Storage Temp | Store at 2-8°C |
| Shipped In | Wet ice |
| Stability And Storage | Upon delivery aliquot, Store at 2-8°C for 24 months |
| CAS | 11096-37-0 |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0202952 | Certificate of Analysis | Mar 01, 2024 | rp155948 |
| ZJ24F0202951 | Certificate of Analysis | Mar 01, 2024 | rp155948 |
| ZJ24F0202950 | Certificate of Analysis | Mar 01, 2024 | rp155948 |
| ZJ23F0300086 | Certificate of Analysis | Mar 25, 2023 | rp155948 |
| ZJ23F0300085 | Certificate of Analysis | Mar 25, 2023 | rp155948 |
| Pictogram(s) | GHS07 |
|---|---|
| Signal | Warning |
| Hazard Statements | H332:Harmful if inhaled |
| Precautionary Statements | P261:Avoid breathing dust/fume/gas/mist/vapors/spray. P271:Use only outdoors or in a well-ventilated area. P304+P340:IF INHALED: Remove person to fresh air and keep comfortable for breathing. P317:Get emergency medical help. |
