Determine the necessary mass, volume, or concentration for preparing a solution.
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
Immunology & Inflammation related Antibodies
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
R412001-1mg | 1mg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $199.90 | |
R412001-5mg | 5mg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $664.90 | |
R412001-10mg | 10mg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $1,194.90 | |
R412001-25mg | 25mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,686.90 |
Immunology & Inflammation related Antibodies
Product Name | Rituximab (anti-CD20) - Primary antibody |
---|---|
Synonyms | IDEC-C2B8 |
Specifications & Purity | ≥97%, Lot by Lot |
Conjugation | Unconjugated |
Action Type | BINDING AGENT |
Mechanism of action | BINDING AGENT of B-lymphocyte antigen CD20 binding agent |
Product Description | Information Rituximab (anti-CD20) Rituximab (anti-CD20) is a chimeric anti-CD20 mAb that binds the CD20 antigen on B cells with a binding affinity of 5 nM, MW: 143.86 KD. |
Light Chain Type | >Rituximab light chain chimeric QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC |
---|---|
Concentration | Lot by Lot |
Storage Temp | Protected from light,Store at -20°C |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20℃ for two years. Upon delivery aliquot. Avoid freeze/thaw cycle. |
CAS | 174722-31-7 |
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
ZJ23F0300042 | Certificate of Analysis | Mar 14, 2023 | R412001 |
ZJ23F0300043 | Certificate of Analysis | Mar 14, 2023 | R412001 |
ZJ23F0300044 | Certificate of Analysis | Mar 14, 2023 | R412001 |